Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nocardia farcinica Probable cytochrome c oxidase subunit 3(ctaE)

Recombinant Nocardia farcinica Probable cytochrome c oxidase subunit 3(ctaE)

SKU:CSB-CF726446NAAA

Regular price $1,936.25 CAD
Regular price Sale price $1,936.25 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Nocardia farcinica (strain IFM 10152)

Uniprot NO.:Q5YZ19

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTAVGTPGSAITQRVHSLNRPNMVSVGTIIWLSSELMFFAGLFAMYFVARAQANGNWPP EPTELNLKLAVPVTAVLVASSFTCQMGVFAAEKGDVFGLRRWYFITLLMGAFFVAGQGYE YYHLVHEGTSISSSAYGSVFYITTGFHGLHVIGGLIAFVFLLIRTKVSKFTPAQATAAIV VSYYWHFVDIVWIGLFATIYFVR

Protein Names:Recommended name: Probable cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome aa3 subunit 3 Cytochrome c oxidase polypeptide III

Gene Names:Name:ctaE Ordered Locus Names:NFA_17260

Expression Region:1-203

Sequence Info:full length protein

View full details