Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nocardia farcinica Probable cytochrome c oxidase polypeptide 4(ctaF)

Recombinant Nocardia farcinica Probable cytochrome c oxidase polypeptide 4(ctaF)

SKU:CSB-CF733487NAAA

Regular price $2,073.40 CAD
Regular price Sale price $2,073.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nocardia farcinica (strain IFM 10152)

Uniprot NO.:Q5YZ36

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRIEARIFELLTVFFIIVGVVYGFFTAQSRTGVEWAGTTAIVLTAGLSLIIGTYFRFVAR RLDLRPEDYEDAEIVDGAGDLGFFSPGSFWPILLAGAGSVAALGLAFFEPWLIAVGVICV IAAAAGLVFEYHLGPEKH

Protein Names:Recommended name: Probable cytochrome c oxidase polypeptide 4 EC= 1.9.3.1 Alternative name(s): Cytochrome aa3 subunit 4 Cytochrome c oxidase polypeptide IV

Gene Names:Name:ctaF Ordered Locus Names:NFA_17090

Expression Region:1-138

Sequence Info:full length protein

View full details