Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nitrosospira multiformis Probable intracellular septation protein A(Nmul_A2111)

Recombinant Nitrosospira multiformis Probable intracellular septation protein A(Nmul_A2111)

SKU:CSB-CF650518NAAH

Regular price $2,136.40 CAD
Regular price Sale price $2,136.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849)

Uniprot NO.:Q2Y767

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKFLFDLFPVILFFITFKIYGIYAATAVAIGATFAQIGWVWFRHGKVDTMLWVSLVLIVV FGSATLILQDETFIKWKPSVLYWLFAAALLIAQAIFKKNFIRTMMKEQLTLPEPVWARVN ASWAAFFAFMGAANLYVAFNYSTETWVNFKLFGFMGLMLVFVVLQGLMLSKYMATDEDKE A

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Nmul_A2111

Expression Region:1-181

Sequence Info:full length protein

View full details