Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nitrosomonas europaea Probable intracellular septation protein A(NE0055)

Recombinant Nitrosomonas europaea Probable intracellular septation protein A(NE0055)

SKU:CSB-CF767731NHH

Regular price $2,136.40 CAD
Regular price Sale price $2,136.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298)

Uniprot NO.:Q82Y34

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKFLFDLFPVILFFITYKVYGIYNATAVAIIATFVQIGWVWLRHRKVDNMLWVSLAIIVV FGGATLIFQDETFIKWKPTVLYWLFAAVLFLANQIFEKNLIRVMMKDQIRLPEPVWPRLN ASWAVFFSVMGIINLYVAYNYSTDTWVNFKLFGFMGLMFAFVILQAILLGKYVEKSDDQE I

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:NE0055

Expression Region:1-181

Sequence Info:full length protein

View full details