Recombinant Neurospora crassa Vacuolar ATPase assembly integral membrane protein VMA21(vma-21)

SKU: CSB-CF759632NHA

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Uniprot NO.:Q7S158

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATRRIISQEKTLLEKDDRIGSSPAASEKSNITPAVPASVIIKLLAFTFAMIVIPISSYF LTVDRLFKGNSTYAGATAAIMANVVLIGYIIVAMAEDQSDQENEKKGGGGKGEGKKDL

Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21

Gene Names:Name:vma-21 ORF Names:NCU09107

Expression Region:1-118

Sequence Info:full length protein