Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neurospora crassa Mitochondrial inner membrane organizing system protein NCU06495(NCU06495)

Recombinant Neurospora crassa Mitochondrial inner membrane organizing system protein NCU06495(NCU06495)

SKU:CSB-CF745771NHA

Regular price $1,791.25 CAD
Regular price Sale price $1,791.25 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Uniprot NO.:Q7RYI0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDSTSSPVAAAPSTAMTRPVSEALLNEKWDRCLSNLLIKSTLGLGFGVVFSVLIFKRRA WPAFVGVGFGAGRAYEECNTSLKQAAREIRAQA

Protein Names:Recommended name: Mitochondrial inner membrane organizing system protein NCU06495

Gene Names:ORF Names:NCU06495

Expression Region:1-93

Sequence Info:full length protein

View full details