Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Uniprot NO.:Q7RYI0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSDSTSSPVAAAPSTAMTRPVSEALLNEKWDRCLSNLLIKSTLGLGFGVVFSVLIFKRRA WPAFVGVGFGAGRAYEECNTSLKQAAREIRAQA
Protein Names:Recommended name: Mitochondrial inner membrane organizing system protein NCU06495
Gene Names:ORF Names:NCU06495
Expression Region:1-93
Sequence Info:full length protein