Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-21(tim-21)

Recombinant Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-21(tim-21)

SKU:CSB-CF752558NHA

Regular price $2,164.40 CAD
Regular price Sale price $2,164.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Uniprot NO.:Q7S8S5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATTQESSKRRSVTPFNDDGHVPWTRLSTGEKAGRAVQQTFNFGLVILGVVLTGGIAYLLF TDVFSPESKTAYFNRAVDRIRADPRCVALLSPGDPKKIAAHGEETHNKWRRARPIAATVE KDNRGVEHLKMHFHVEGPRGSGVVGLHLTKQPGHWEHEYQTFYVDVRGHQRIYLENKEAE VAAAKKGGNKEFKFLGVKWN

Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit tim-21

Gene Names:Name:tim-21 ORF Names:NCU08810

Expression Region:52-251

Sequence Info:full length protein

View full details