Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neurospora crassa Cytochrome b-c1 complex subunit Rieske, mitochondrial (NCU06606)

Recombinant Neurospora crassa Cytochrome b-c1 complex subunit Rieske, mitochondrial (NCU06606)

SKU:CSB-CF362027NHA

Regular price $2,163.00 CAD
Regular price Sale price $2,163.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Uniprot NO.:P07056

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GSSSSTFESPFKGESKAAKVPDFGKYMSKAPPSTNMLFSYFMVGTMGAITAAGAKSTIQE FLKNMSASADVLAMAKVEVDLNAIPEGKNVIIKWRGKPVFIRHRTPAEIEEANKVNVATL RDPETDADRVKKPEWLVMLGVCTHLGCVPIGEAGDYGGWFCPCHGSHYDISGRIRKGPAP LNLEIPLYEFPEEGKLVIG

Protein Names:Recommended name: Cytochrome b-c1 complex subunit Rieske, mitochondrial EC= 1.10.2.2 Alternative name(s): Complex III subunit 5 Rieske iron-sulfur protein Short name= RISP Ubiquinol-cytochrome c reductase iron-sulfur subunit

Gene Names:ORF Names:NCU06606

Expression Region:33-231

Sequence Info:full length protein

View full details