Recombinant Neurospora crassa Cyanovirin-N homolog(NCU05495)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Neurospora crassa Cyanovirin-N homolog(NCU05495)

CSB-EP742424NHA
Regular price
$1,133.75 CAD
Sale price
$1,133.75 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q7S6U4

Gene Names: NCU05495

Organism: Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

AA Sequence: MSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRARLRDCNGEFHDRDVNLTEIVENVNGEFQAKF

Expression Region: 1-111aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 16.9 kDa

Alternative Name(s):

Relevance: Mannose-binding lectin.

Reference: "A designed chimeric cyanovirin-N homolog lectin: structure and molecular basis of sucrose binding." Koharudin L.M., Furey W., Gronenborn A.M. Proteins 77:904-915(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share