Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Uniprot NO.:P00842
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:YSSEIAQAMVEVSKNLGMGSAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILG FAFVEAIGLFDLMVALMAKFT
Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein
Gene Names:Name:oli Synonyms:atp-9, atp9, prl-1 ORF Names:B13D24.340, NCU02250
Expression Region:67-147
Sequence Info:full length protein