Gene Bio Systems
Recombinant Nematostella vectensis Protein SYS1 homolog(sys1)
Recombinant Nematostella vectensis Protein SYS1 homolog(sys1)
SKU:CSB-CF023027NGO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nematostella vectensis (Starlet sea anemone)
Uniprot NO.:A7S6Y0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAAGFRTNVWDPVLIISQIIAIQCTFYISLGVWVLIVDYWSGSIHSLDQFFAYKELDISS LKGKLLMIAFCLNSLTGAMALWFIVKRAKQCLDFTTTAHIVHLVFCCIYAGFPFSWTWWL LNIICLALMAVIGEFVCMKTELKAIKVSAGSSGKNSV
Protein Names:Recommended name: Protein SYS1 homolog
Gene Names:Name:sys1 ORF Names:v1g229542
Expression Region:1-157
Sequence Info:full length protein
