Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neisseria meningitidis serogroup C - serotype 2a UPF0756 membrane protein NMC1845 (NMC1845)

Recombinant Neisseria meningitidis serogroup C - serotype 2a UPF0756 membrane protein NMC1845 (NMC1845)

SKU:CSB-CF375492NEX

Regular price $2,087.40 CAD
Regular price Sale price $2,087.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / FAM18)

Uniprot NO.:A1KVV6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNFSFVPLFLVTLILLGVVSNNNSITISATILLLMQQTALVQFVPLVEKHGLNLGIILLT IGVLSPLVSGKAQVPPVAEFLNFKMISAVFIGIFVAWLAGRGVPLMGQQPVLITGLLIGT VIGVAFMGGIPVGPLIAAGILSFVVGKG

Protein Names:Recommended name: UPF0756 membrane protein NMC1845

Gene Names:Ordered Locus Names:NMC1845

Expression Region:1-148

Sequence Info:full length protein

View full details