Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neisseria meningitidis serogroup C - serotype 2a UPF0059 membrane protein NMC0207 (NMC0207)

Recombinant Neisseria meningitidis serogroup C - serotype 2a UPF0059 membrane protein NMC0207 (NMC0207)

SKU:CSB-CF375432NEX

Regular price $2,146.20 CAD
Regular price Sale price $2,146.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / FAM18)

Uniprot NO.:A1KRP4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLYALLLIALGMSMDAFAVALAKGAAVRMPPRKIAATALVFGTVEALTPLAGWVGGFYA KPFISEWDHWAAFVLLGGLGLKMMHEGLSGEAEDARENKRESWWLTVLTAFGTSIDSMIV GVGLAFMEVNIAFAAAIIGMATTVLVAVGLTVGRALGVLFGRRAEFAGGLVLIAIGTWTL LSHLGLIG

Protein Names:Recommended name: UPF0059 membrane protein NMC0207

Gene Names:Ordered Locus Names:NMC0207

Expression Region:1-188

Sequence Info:full length protein

View full details