Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neisseria meningitidis serogroup B UPF0059 membrane protein NMB0215(NMB0215)

Recombinant Neisseria meningitidis serogroup B UPF0059 membrane protein NMB0215(NMB0215)

SKU:CSB-CF878216NGG

Regular price $2,146.20 CAD
Regular price Sale price $2,146.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Neisseria meningitidis serogroup B (strain MC58)

Uniprot NO.:Q9K1E1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGFYALLLIALGMSMDAFAVALAKGAAVRMPPRKIAATALVFGTVEALTPLAGWVGGFYA KPFISEWDHWVAFVLLGGLGLKMMREGLSGEAEDVRESKRESLWMTVLTAFGTSIDSMIV GVGLAFMEVNIAFAAAIIGMATTVMVAVGLTAGRALGVLFGRCAEFAGGLVLIAIGTWTL LSHLGLIQ

Protein Names:Recommended name: UPF0059 membrane protein NMB0215

Gene Names:Ordered Locus Names:NMB0215

Expression Region:1-188

Sequence Info:full length protein

View full details