![Recombinant Neisseria meningitidis serogroup B - serotype 15 Major outer membrane protein P.IB(porB)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_70a2200a-a008-498e-962a-e194d3767f3b_{width}x.jpg?v=1659192393)
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Signal Transduction
Target / Protein: porB
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Neisseria meningitidis serogroup B / serotype 15 (strain H44/76)
Delivery time: 3-7 business days
Uniprot ID: E6MZM0
AA Sequence: DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 20-331aa
Protein length: Full Length of Mature Protein
MW: 49.8 kDa
Alternative Name(s): Class 3 protein Porin
Relevance: Serves as a slightly cation selective porin.
Reference: "Neisseria meningitidis is structured in clades associated with restriction modification systems that modulate homologous recombination." Budroni S., Siena E., Hotopp J.C., Seib K.L., Serruto D., Nofroni C., Comanducci M., Riley D.R., Daugherty S.C., Angiuoli S.V., Covacci A., Pizza M., Rappuoli R., Moxon E.R., Tettelin H., Medini D.Proc. Natl. Acad. Sci. U.S.A. 108:4494-4499(2011)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.