Gene Bio Systems
Recombinant Neisseria meningitidis serogroup B Probable intracellular septation protein A (NMB0342)
Recombinant Neisseria meningitidis serogroup B Probable intracellular septation protein A (NMB0342)
SKU:CSB-CF353880NGG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neisseria meningitidis serogroup B (strain MC58)
Uniprot NO.:P65196
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKFVSDLLSVILFFATYTVTKNMIAATAVALVAGVVQAAFLYWKYKKLDTMQWVGLVLIV VFGGATIVLGDSRFIMWKPSVLFWLGALFLWGSHLAGKNGLKASIGREIQLPDAVWAKLT YMWVGFLIFMGIANWFVFTRFESQWVNYKMFGSTALMLVFFIIQGIYLSTCLKKED
Protein Names:Recommended name: Probable intracellular septation protein A
Gene Names:Ordered Locus Names:NMB0342
Expression Region:1-176
Sequence Info:full length protein
