Gene Bio Systems
Recombinant Neisseria meningitidis serogroup A - serotype 4A Na(+)-translocating NADH-quinone reductase subunit C(nqrC)
Recombinant Neisseria meningitidis serogroup A - serotype 4A Na(+)-translocating NADH-quinone reductase subunit C(nqrC)
SKU:CSB-CF864419NGF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
Uniprot NO.:Q9JVQ0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAKKFDKDSFSGTLIVVLAVSLICSVIVAGAVVGLKPIQEKQKLQDKQGYILSVAGLMDK DTDIGKTFAERIEQRVVDLATGEYVKDAPKDFSARIAGKDPAQSIRIKPEDDLAGIKSRA KYTEVYLVKGEDGKIGQIILPMHGNGLWSVMYGFVAIQPDGNTINGITYYEQGETPGLGG EIGNPLWQQKFVGKKLFDGQGKLALHVGKGAGSDKEHGVDALSGASLTSKGVQGSFAYWF GENGYIPYLNKLKSAGAQ
Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit C Short name= Na(+)-NQR subunit C Short name= Na(+)-translocating NQR subunit C EC= 1.6.5.- Alternative name(s): NQR complex subunit C NQR-1 subunit C
Gene Names:Name:nqrC Ordered Locus Names:NMA0750
Expression Region:1-258
Sequence Info:full length protein
