Recombinant Nasturtium officinale NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic

SKU: CSB-CF390672NEV

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nasturtium officinale (Water-cress) (Rorippa nasturtium-aquaticum)

Uniprot NO.:A4QLY7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MILEHVLVLSAYLFLIGLYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGD IFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 4L NADH-plastoquinone oxidoreductase subunit 4L

Gene Names:Name:ndhE

Expression Region:1-101

Sequence Info:full length protein