Recombinant Naja mossambica Cytotoxin 5

SKU: CSB-EP329557NAH

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P25517

Gene Names: N/A

Organism: Naja mossambica (Mozambique spitting cobra)

AA Sequence: LKCKKLIPLFSKTCPEGKNLCYKMTMRLAPKVPVKRGCIDVCPKSSFLVKYECCDTDRCN

Expression Region: 1-60aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 10.8 kDa

Alternative Name(s): CTX M51 CTX V

Relevance: Shows cytolytic activity on many different cells by forming pore in lipid membranes. In vivo, increases heart rate or kills the animal by cardiac arrest. In addition, it binds to heparin with high affinity, interacts with Kv channel-interacting protein 1 (KCNIP1) in a calcium-independent manner, and binds to integrin alpha-V/beta-3 (ITGAV/ITGB3) with moderate affinity.

Reference: "Are interactions with phospholipids responsible for pharmacological activities of cardiotoxins?" Bougis P.E., Tessier M., van Rietschoten J., Rochat H., Faucon J.F., Dufourcq J. Mol. Cell. Biochem. 55:49-64(1983)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.