Skip to product information
1 of 1

Gene Bio Systems

Recombinant NADH-ubiquinone oxidoreductase chain 2(ND2)

Recombinant NADH-ubiquinone oxidoreductase chain 2(ND2)

SKU:CSB-CF015077DZV-GB

Regular price $2,014.60 CAD
Regular price Sale price $2,014.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cyanidium caldarium

Uniprot NO.:P48904

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:PLAGFFSKLFVFTACLQSSLYFLTFIGILLSGITAFYYIQIIKIIYFGRLNFWSIYIPID KSNAVMISITTLLLILFFADNSIFITSNLVSLNIFHFLK

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 2 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 2

Gene Names:Name:ND2 Synonyms:NAD2

Expression Region:1-99

Sequence Info:full length protein

View full details