Skip to product information
1 of 1

Gene Bio Systems

Recombinant Na(+)-H(+) antiporter subunit G1

Recombinant Na(+)-H(+) antiporter subunit G1

SKU:CSB-CF350826FKZ

Regular price $1,825.00 CAD
Regular price Sale price $1,825.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus

Uniprot NO.:P60698

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Protein Names:Recommended name: Na(+)/H(+) antiporter subunit G1 Alternative name(s): Mnh complex subunit G1 Mrp complex subunit G1

Gene Names:Name:mnhG1 Synonyms:mrpG1

Expression Region:1-118

Sequence Info:full length protein

View full details