Recombinant Mycoplasma pneumoniae  Uncharacterized protein MPN_594 (MPN_594)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_594 (MPN_594)

CSB-CF301089MLW
Regular price
$1,464.00 CAD
Sale price
$1,464.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Uniprot NO.:P75191

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNFSRRSLRVGAIVNVSVRSLLMRGKNRNKCNSIIFLTVGLLLFIAALALGVLVLFNGYQ VNVNANGVDLKPFEIVHFPFAVKTFLSVLTFVLAAFGFVCMVASFLYFVSFKKLKPKANS AS

Protein Names:Recommended name: Uncharacterized protein MPN_594

Gene Names:Ordered Locus Names:MPN_594 ORF Names:D02_orf122A, MP248

Expression Region:1-122

Sequence Info:full length protein

Your list is ready to share