Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG076 homolog (MPN_214)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG076 homolog (MPN_214)

SKU:CSB-CF303439MLW

Regular price $2,073.40 CAD
Regular price Sale price $2,073.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Uniprot NO.:P75555

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLGTQTTNSKPREYGGLIVSTIYIVLFFAILNLTVFFNKTNNINLILKNSCVVSFVVVWL LVCLQGIVRLKTCDGARYEISKFNQYLKLGSIYAKPNISFDEYKAKSSSYRKQTRGFWWM NFSLYLLGSLISIVVSLL

Protein Names:Recommended name: Uncharacterized protein MG076 homolog

Gene Names:Ordered Locus Names:MPN_214 ORF Names:G07_orf138, MP617

Expression Region:1-138

Sequence Info:full length protein

View full details