Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG055.2 homolog (MPN_070)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG055.2 homolog (MPN_070)

SKU:CSB-CF300427MLW

Regular price $2,056.60 CAD
Regular price Sale price $2,056.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Uniprot NO.:P75047

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MKVIKKLNLLNELTMLVCIFFFVCTISLIGIGIMYDLINRTSLSAPRRDPIFRNLNTVLI VLGVLEILLMVAQLVMSNMAANIINEVAENVEQKFAKALKWSRFLPFGLLQLYCYHKIKL VTQTDNI

Protein Names:Recommended name: Uncharacterized protein MG055.2 homolog

Gene Names:Ordered Locus Names:MPN_070 ORF Names:D09_orf127a, MP085

Expression Region:1-127

Sequence Info:full length protein

View full details