Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycoplasma genitalium Uncharacterized protein MG267 (MG267)

Recombinant Mycoplasma genitalium Uncharacterized protein MG267 (MG267)

SKU:CSB-CF342897MLN

Regular price $2,038.40 CAD
Regular price Sale price $2,038.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

Uniprot NO.:P47509

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLLFKLVKIAILVFLMVIGFFIFIGSFWLNTYQTAQWADLLASSDASGIILTIFPNINS WFNATVANQPVLFKTMVHFFIPVGFGLLFGLIIAIIVDILYRLTKYAIKRSYQSN

Protein Names:Recommended name: Uncharacterized protein MG267

Gene Names:Ordered Locus Names:MG267

Expression Region:1-115

Sequence Info:full length protein

View full details