![Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_48932b84-fac5-4437-afbf-a6de5d35ebeb_{width}x.jpg?v=1659192424)
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: others
Target / Protein: mpt64
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Delivery time: 3-7 business days
Uniprot ID: P0A5Q4
AA Sequence: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Tag info: N-terminal 6xHis-tagged
Expression Region: 24-228aa
Protein length: Full Length
MW: 26.4 kDa
Alternative Name(s): Antigen MPT64
Relevance:
Reference: "High-level heterologous expression and secretion in rapidly growing nonpathogenic mycobacteria of four major Mycobacterium tuberculosis extracellular proteins considered to be leading vaccine candidates and drug targets." Harth G., Lee B.Y., Horwitz M.A. Infect. Immun. 65:2321-2328(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.