Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P9WJA3
Gene Names: hrp1
Organism: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
AA Sequence: MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
Expression Region: 1-143aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 35.5 kDa
Alternative Name(s):
Relevance: Unlike some other CBS-domain containing proteins does not seem to bind AMP.
Reference: "Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin." Sherman D.R., Voskuil M., Schnappinger D., Liao R., Harrell M.I., Schoolnik G.K. Proc. Natl. Acad. Sci. U.S.A. 98:7534-7539(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.