Gene Bio Systems
Recombinant Mycobacterium sp. UPF0060 membrane protein Mkms_2558 (Mkms_2558)
Recombinant Mycobacterium sp. UPF0060 membrane protein Mkms_2558 (Mkms_2558)
SKU:CSB-CF379020MOM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium sp. (strain KMS)
Uniprot NO.:A1UFZ7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLTGVLVLKSAALFVLAALLEIGGAWLVWQGVREHRGWIWAGAGVIALGAYGFVAAFQPD AHFGRILAAYGGVFVAGSLLWGVVVDGFRPDRWDLTGALVCLVGVGLIMYAPR
Protein Names:Recommended name: UPF0060 membrane protein Mkms_2558
Gene Names:Ordered Locus Names:Mkms_2558
Expression Region:1-113
Sequence Info:full length protein
