1 1

Gene Bio Systems

Recombinant Mycobacterium smegmatis NADH-quinone oxidoreductase subunit K(nuoK)

Recombinant Mycobacterium smegmatis NADH-quinone oxidoreductase subunit K(nuoK)

CSB-CF367981MVX

$2,014.60 CAD
$2,014.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

Uniprot NO.:A0QU26

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MNPDNYLYLSALLFTIGAAGVLLRRNAIVMFMCVELMLNAANLAFVNFSRMHGQLDGQVV AFFTMVVAACEVVVGLAIIMAIFRTRRSASVDDANLLKH

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K NDH-1 subunit K

Gene Names:Name:nuoK Ordered Locus Names:MSMEG_2053

Expression Region:1-99

Sequence Info:full length protein

View full details