Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
Uniprot NO.:C1AJ08
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQA PTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH
Protein Names:Recommended name: UPF0233 membrane protein JTY_0011
Gene Names:Ordered Locus Names:JTY_0011
Expression Region:1-93
Sequence Info:full length protein