Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium bovis UPF0060 membrane protein JTY_2660 (JTY_2660)

Recombinant Mycobacterium bovis UPF0060 membrane protein JTY_2660 (JTY_2660)

SKU:CSB-CF508065MVI

Regular price $2,031.40 CAD
Regular price Sale price $2,031.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

Uniprot NO.:C1AFB2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGR VLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH

Protein Names:Recommended name: UPF0060 membrane protein JTY_2660

Gene Names:Ordered Locus Names:JTY_2660

Expression Region:1-110

Sequence Info:full length protein

View full details