
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: hspX
Biologically active: Not Tested
Expression system: Baculovirus
Species of origin: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Delivery time: 3-7 business days
Uniprot ID: P0A5B8
AA Sequence: ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Tag info: N-terminal 6xHis-tagged
Expression Region: 2-144aa
Protein length: Full Length
MW: 18.1 kDa
Alternative Name(s): 16 kDa antigen HSP 16.3
Relevance:
Reference: "Updated reference genome sequence and annotation of Mycobacterium bovis AF2122/97." Malone K.M., Farrell D., Stuber T.P., Schubert O.T., Aebersold R., Robbe-Austerman S., Gordon S.V. Genome Announc. 5:E00157-E00157(2017)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.