Gene Bio Systems
Recombinant Murid herpesvirus 1 Glycoprotein N(GN)
Recombinant Murid herpesvirus 1 Glycoprotein N(GN)
SKU:CSB-CF724335MJT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Murid herpesvirus 1 (strain Smith) (MuHV-1) (Mouse cytomegalovirus)
Uniprot NO.:Q69150
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MACGKTESGDDSGRFGRTGAGMFGFIMPGFVGIFRLSFFLLLSFAMASGSSSPASVPVSV AASVPDTTVNKIVISDGSEAHNINEFYDVKCHSHFYGLSVSSFASIWMMVNAIVFICAFG VFMRHWCYKAFTSDTAKGY
Protein Names:Recommended name: Glycoprotein N Short name= gN Alternative name(s): Structural glycoprotein UL73 Short name= gpUL73
Gene Names:Name:GN ORF Names:UL73
Expression Region:1-139
Sequence Info:full length protein
