Recombinant Mouse Vomeronasal secretory protein 1(Lcn3)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Vomeronasal secretory protein 1(Lcn3)

CSB-EP730794MO
Regular price
$1,151.28 CAD
Sale price
$1,151.28 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q62471

Gene Names: Lcn3

Organism: Mus musculus (Mouse)

AA Sequence: QDSSFLAFNNGNFSGKWFLKALVSEDDIPINKVSPMLILVLNNGDIELSITHMIYDQCLEVTTILEKTDVPGQYLAFEGKTHLQVQLSSVKGHYMLYCDGEIEGMRFLMTQLIGRDPQENLEALEEFKVFTQIKGLVAENLVILEQMEKCEPESFYELPSRPSE

Expression Region: 19-182aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 34.7 kDa

Alternative Name(s): Lipocalin-3 Vomeronasal secretory protein I Short name: VNSP I

Relevance: Transport of lipophilic molecules, possible pheromone-carrier.

Reference: "Possible pheromone-carrier function of two lipocalin proteins in the vomeronasal organ."Miyawaki A., Matsushita F., Ryo Y., Mikoshiba K. EMBO J. 13:5835-5842(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share