
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q62471
Gene Names: Lcn3
Organism: Mus musculus (Mouse)
AA Sequence: QDSSFLAFNNGNFSGKWFLKALVSEDDIPINKVSPMLILVLNNGDIELSITHMIYDQCLEVTTILEKTDVPGQYLAFEGKTHLQVQLSSVKGHYMLYCDGEIEGMRFLMTQLIGRDPQENLEALEEFKVFTQIKGLVAENLVILEQMEKCEPESFYELPSRPSE
Expression Region: 19-182aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 34.7 kDa
Alternative Name(s): Lipocalin-3 Vomeronasal secretory protein I Short name: VNSP I
Relevance: Transport of lipophilic molecules, possible pheromone-carrier.
Reference: "Possible pheromone-carrier function of two lipocalin proteins in the vomeronasal organ."Miyawaki A., Matsushita F., Ryo Y., Mikoshiba K. EMBO J. 13:5835-5842(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.