Recombinant Mouse Uroplakin-2(Upk2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Uroplakin-2(Upk2)

CSB-EP025656MO
Regular price
$979.56 CAD
Sale price
$979.56 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P38575

Gene Names: Upk2

Organism: Mus musculus (Mouse)

AA Sequence: ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK

Expression Region: 85-184aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-GST-tagged

MW: 40.8 kDa

Alternative Name(s): Uroplakin II

Relevance: Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM.

Reference: "A tissue-specific promoter that can drive a foreign gene to express in the suprabasal urothelial cells of transgenic mice." Lin J.-H., Zhao H., Sun T.-T. Proc. Natl. Acad. Sci. U.S.A. 92:679-683(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share