Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: P38575
Gene Names: Upk2
Organism: Mus musculus (Mouse)
AA Sequence: ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK
Expression Region: 85-184aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-GST-tagged
MW: 40.8 kDa
Alternative Name(s): Uroplakin II
Relevance: Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM.
Reference: "A tissue-specific promoter that can drive a foreign gene to express in the suprabasal urothelial cells of transgenic mice." Lin J.-H., Zhao H., Sun T.-T. Proc. Natl. Acad. Sci. U.S.A. 92:679-683(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.