Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Uncharacterized protein C4orf32 homolog

Recombinant Mouse Uncharacterized protein C4orf32 homolog

SKU:CSB-CF880454MO

Regular price $1,841.25 CAD
Regular price Sale price $1,841.25 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9CZL2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCSARKLLRGGAGSAGGECDEDGAAPAGRVEEPEHGASPRRRRPQDEGEQDIEEPQNHSG EPIGDDYKKMGTLFGELNKNLLNMGFTRMYFGERIVEPVVVLFFWLMLWFLGLQALGLVA VLCLVIIYVQQ

Protein Names:Recommended name: Uncharacterized protein C4orf32 homolog

Gene Names:

Expression Region:1-131

Sequence Info:full length protein

View full details