Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Tumor necrosis factor receptor superfamily member 6(Fas)

Recombinant Mouse Tumor necrosis factor receptor superfamily member 6(Fas)

SKU:CSB-CF008433MO

Regular price $2,321.20 CAD
Regular price Sale price $2,321.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P25446

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE

Protein Names:Recommended name: Tumor necrosis factor receptor superfamily member 6 Alternative name(s): Apo-1 antigen Apoptosis-mediating surface antigen FAS FASLG receptor CD_antigen= CD95

Gene Names:Name:Fas Synonyms:Apt1, Tnfrsf6

Expression Region:22-327

Sequence Info:full length protein

View full details