Recombinant Mouse Tumor necrosis factor receptor superfamily member 4(Tnfrsf4),partial

SKU: CSB-EP023981MO

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P47741

Gene Names: Tnfrsf4

Organism: Mus musculus (Mouse)

AA Sequence: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP

Expression Region: 20-211aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 37.3 kDa

Alternative Name(s): OX40 antigen OX40L receptor CD_antigen: CD134

Relevance: Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).

Reference: "Cloning of mouse Ox40: a T cell activation marker that may mediate T-B cell interactions."Calderhead D.M., Buhlmann J.E., van den Eertwegh A.J., Claassen E., Noelle R.J., Fell H.J. Immunol. 151:5261-5271(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.