Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Tumor necrosis factor ligand superfamily member 8(Tnfsf8)

Recombinant Mouse Tumor necrosis factor ligand superfamily member 8(Tnfsf8)

SKU:CSB-CF023996MO

Regular price $2,221.80 CAD
Regular price Sale price $2,221.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P32972

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEPGLQQAGSCGAPSPDPAMQVQPGSVASPWRSTRPWRSTSRSYFYLSTTALVCLVVAVAIILVLVVQKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD

Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 8 Alternative name(s): CD30 ligand Short name= CD30-L CD_antigen= CD153

Gene Names:Name:Tnfsf8 Synonyms:Cd30l, Cd30lg

Expression Region:1-239

Sequence Info:full length protein

View full details