Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Tumor necrosis factor ligand superfamily member 12(Tnfsf12)

Recombinant Mouse Tumor necrosis factor ligand superfamily member 12(Tnfsf12)

SKU:CSB-CF023987MO

Regular price $2,237.20 CAD
Regular price Sale price $2,237.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O54907

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAARRSQRRRGRRGEPGTALLAPLVLSLGLALACLGLLLVVVSLGSWATLSAQEPSQEELTAEDRREPPELNPQTEESQDVVPFLEQLVRPRRSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 12 Alternative name(s): TNF-related weak inducer of apoptosis Short name= TWEAK Cleaved into the following 2 chains: 1. Tumor necrosis factor ligand superfamily member 12, membrane form 2. Tumor necrosis factor ligand superfamily member 12, secreted form

Gene Names:Name:Tnfsf12

Expression Region:1-249

Sequence Info:full length protein

View full details