Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Neuroscience
Uniprot ID: P07309
Gene Names: Ttr
Organism: Mus musculus (Mouse)
AA Sequence: AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Expression Region: 23-147aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 40.5 kDa
Alternative Name(s): Prealbumin
Relevance: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Reference: "Structural comparisons between mouse and human prealbumin." Wakasugi S., Maeda S., Shimada K., Nakashima H., Migita S. J. Biochem. 98:1707-1714(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.