Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Transmembrane protein 170A(Tmem170a)

Recombinant Mouse Transmembrane protein 170A(Tmem170a)

SKU:CSB-CF023751MO

Regular price $2,081.80 CAD
Regular price Sale price $2,081.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9D342

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEREGSGGGGGSAGLLQQILSLKLVPRVGNGTLCPNSTSLCSFPEMWYGVFLWALMSSVF FHVPAGLLALFTLRHHKYGRFMSVSILLMGIVGPITAGILTSAAIAGVYRAAGKEMIPFE ALTLGTGQTFCVVVVSFLRVLATL

Protein Names:Recommended name: Transmembrane protein 170A

Gene Names:Name:Tmem170a Synonyms:D8Bwg1414e, Tmem170

Expression Region:1-144

Sequence Info:full length protein

View full details