Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Taste receptor type 2 member 105(Tas2r105)

Recombinant Mouse Taste receptor type 2 member 105(Tas2r105)

SKU:CSB-CF872873MO

Regular price $2,312.80 CAD
Regular price Sale price $2,312.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9JKT4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLSAAEGILLSIATVEAGLGVLGNTFIALVNCMDWAKNNKLSMTGFLLIGLATSRIFIVW LLTLDAYAKLFYPSKYFSSSLIEIISYIWMTVNHLTVWFATSLSIFYFLKIANFSDCVFL WLKRRTDKAFVFLLGCLLTSWVISFSFVVKVMKDGKVNHRNRTSEMYWEKRQFTINYVFL NIGVISLFMMTLTACFLLIMSLWRHSRQMQSGVSGFRDLNTEAHVKAIKFLISFIILFVL YFIGVSIEIICIFIPENKLLFIFGFTTASIYPCCHSFILILSNSQLKQAFVKVLQGLKFF

Protein Names:Recommended name: Taste receptor type 2 member 105 Short name= T2R105 Alternative name(s): Taste receptor type 2 member 5 Short name= T2R5 Taste receptor type 2 member 9 Short name= T2R9

Gene Names:Name:Tas2r105 Synonyms:Tas2r5, Tas2r9

Expression Region:1-300

Sequence Info:full length protein

View full details