Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse T-cell surface glycoprotein CD3 gamma chain(Cd3g)

Recombinant Mouse T-cell surface glycoprotein CD3 gamma chain(Cd3g)

SKU:CSB-CF004933MO

Regular price $2,105.60 CAD
Regular price Sale price $2,105.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P11942

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTISGFIFAEVISIFFLALGVYLIAGQDGVRQSRASDKQTLLQNEQLYQPLKDREYDQYSHLQGNQLRKK

Protein Names:Recommended name: T-cell surface glycoprotein CD3 gamma chain Alternative name(s): T-cell receptor T3 gamma chain CD_antigen= CD3g

Gene Names:Name:Cd3g

Expression Region:23-182

Sequence Info:full length protein

View full details