Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain(Cd3e),partial

Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain(Cd3e),partial

SKU:CSB-YP004931MO

Regular price $1,130.00 CAD
Regular price Sale price $1,130.00 CAD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Immunology

Target / Protein: Cd3e

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P22646

AA Sequence: DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD

Tag info: N-terminal 6xHis-tagged

Expression Region: 23-108aa

Protein length: Extracellular Domain

MW: 11.9 kDa

Alternative Name(s): Alternative name(s): T-cell surface antigen T3/Leu-4 epsilon chain CD_antigen: CD3e

Relevance: The CD3 complex mediates signal transduction, resulting in T cell activation and proliferation. Required for normal immune responses.

Reference: "A tissue-specific atlas of mouse protein phosphorylation and expression."Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.Cell 143:1174-1189(2010).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details