Recombinant Mouse Sodium-potassium-transporting ATPase subunit beta-3(Atp1b3)

SKU: CSB-CF002328MO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P97370

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GSTHPGKALRKAQQKVLTDASVRLAGTALEGNTFYMENAQPQGGSTSSSPVTLQPNVVYI

Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-3 Alternative name(s): Sodium/potassium-dependent ATPase subunit beta-3 Short name= ATPB-3 CD_antigen= CD298

Gene Names:Name:Atp1b3

Expression Region:1-278

Sequence Info:full length protein