Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Proteolipid protein 2(Plp2)

Recombinant Mouse Proteolipid protein 2(Plp2)

SKU:CSB-CF882617MO

Regular price $2,093.00 CAD
Regular price Sale price $2,093.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9R1Q7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADSERLSAPGCWLACTSFSRTKKGILLFAEIILCLVILICFSASTTSAYSSLSVIEMIC AAVLLVFYTCDLHSKISFINWPWTDFFRSLIATILYLITSIVVLVEGRGSSRVVAGILGL LATLLFGYDAYITFPLKQQRHTAAPTDPTDGP

Protein Names:Recommended name: Proteolipid protein 2

Gene Names:Name:Plp2

Expression Region:1-152

Sequence Info:full length protein

View full details