Gene Bio Systems
Recombinant Mouse Protein tyrosine phosphatase receptor type C-associated protein(Ptprcap)
Recombinant Mouse Protein tyrosine phosphatase receptor type C-associated protein(Ptprcap)
SKU:CSB-CF737378MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q64697
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MALPGTLRFGVLMALPGALASGADPEDGVGSSVVTIVLLLLLLLLLVTALALAWRRLSHA SGGYYHPARLGAALWGHTCRLLWASPAGRWLRARTELESPEESGPPEDEEDAEDFVIDGG PEEAAAKEEEQRCQAEQTRDPRDTDSDGGLGLSSQGPVGSGSSAEALLSDLHAFSGSAAW DDSAGGAGGQGLRVTAL
Protein Names:Recommended name: Protein tyrosine phosphatase receptor type C-associated protein Short name= PTPRC-associated protein Alternative name(s): CD45-associated protein Short name= CD45-AP LSM-1
Gene Names:Name:Ptprcap
Expression Region:1-197
Sequence Info:full length protein
