Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Protein transport protein Sec61 subunit gamma(Sec61g)

Recombinant Mouse Protein transport protein Sec61 subunit gamma(Sec61g)

SKU:CSB-CF020959MO

Regular price $1,969.80 CAD
Regular price Sale price $1,969.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P60060

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG

Protein Names:Recommended name: Protein transport protein Sec61 subunit gamma

Gene Names:Name:Sec61g

Expression Region:1-68

Sequence Info:full length protein

View full details