
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: E9PWB6
Gene Names: Muc5ac
Organism: Mus musculus (Mouse)
AA Sequence: CPKNSSLIVTYEEGACCPTQNCSSQKGCEVNGTLYQPGDVVSSSLCERCLCEVSSNPLSDVFMVSCETELCNTQCPKGSEYQAMPGQCCGKCIPKTCPFKNNSGSTYFYQPGELWAEPGNPCVTHKCEKFQDVLMVVTMKTECPKINCPQGQAQLREDGCCYDCPLPNQQKCTVHQRQQIIRQQNCSSEGPVSISYCQGNCGDSISMYSLEANKVEHTCECCQELQTSQRNVTLRCDDGSSQTFSYTQVEKCGCLGQQCHALGDTSHAES
Expression Region: 2452-2721aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 33.6 kDa
Alternative Name(s):
Relevance: Gel-forming glycoprotein of gastric and respiratoy tract epithelia that protects the mucosa from infection and chical damage by binding to inhaled microrganisms and particles that are subsequently roved by the mucocilary syst.
Reference: Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.